PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Jcr4S00151.130
Common NameJCGZ_20417, LOC105645635
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Jatropheae; Jatropha
Family Nin-like
Protein Properties Length: 983aa    MW: 107158 Da    PI: 5.4006
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Jcr4S00151.130genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK924.4e-29574624252
          RWP-RK   2 ekeisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                     ek+isle+l++yF++++kdAAk+Lgvc+T++KriCRq+GI+RWP+Rki+++
  Jcr4S00151.130 574 EKSISLEVLQQYFAGSLKDAAKSLGVCPTTMKRICRQHGISRWPSRKINKV 624
                     799**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151917.734563644IPR003035RWP-RK domain
PfamPF020423.7E-26577624IPR003035RWP-RK domain
SuperFamilySSF542779.48E-23879971No hitNo description
Gene3DG3DSA:3.10.20.2401.7E-26887969No hitNo description
SMARTSM006667.9E-24887969IPR000270PB1 domain
PROSITE profilePS5174524.674887969IPR000270PB1 domain
CDDcd064073.89E-36888968No hitNo description
PfamPF005641.8E-16888968IPR000270PB1 domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009414Biological Processresponse to water deprivation
GO:0010118Biological Processstomatal movement
GO:0010167Biological Processresponse to nitrate
GO:0042128Biological Processnitrate assimilation
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 983 aa     Download sequence    Send to blast
MPEQEEDKSK GNQPPVVAGV GGGGVGGGVR GETLMDLDLD LESSWPLDQI SFLSNPLSPL  60
LLSSSDQPCS PLWAFSDTDD ERLVASASSH ATVPPLPAAA GLRLSDYPIF VTCNTASVNE  120
NPTENDDKRK LPSPLLGLMP IDNPDGYCII KERMTQALRN FKDSTEQHVL AQVWAPVKNG  180
VDGESDGELG LPGRVFRLKL PEWSPNVQYY STKEYSRRDH ALCYNVQGTL ALPVFEPSGQ  240
YCVGVLELIM TSQKINYGPE VDKVCKALEA VNLKSSEILD HPDVYLALLL NQICNEGRKN  300
ALAEILEILT AVCETHKLAL AQTWVPCMHR SVLAYGGGVK KSCTSFDGSC NGQVCMSTTD  360
VAFYVVDPHM WGFREACLEH HLQKGQGVAG RAFSSHSACF CQDITQFCKT EYPLVHYARM  420
FELTSCFAIC LHSSHTGDDE YVLEFFFPSS ISDIYEQKAL LGSMLATMKQ HFQSLKVASG  480
MNLEEEEGFI EIVRTSMTGR LDLGLECIRI PQSPKTPPNT NTLSEGGHMA QIDSIRHQLV  540
VDLAVVDNGG KFPTTHPDNK VNKRPSERKR GKTEKSISLE VLQQYFAGSL KDAAKSLGVC  600
PTTMKRICRQ HGISRWPSRK INKVNRSLSK LKRVIESVQG AEGAFDLTPL ATSPLPVAVG  660
SISWPSNLNG CNQRNSPISK SPEPNGERNG SPLCKTPESN VHAGVDGQLL GGGILSHEEL  720
VLQNRFSPEL GQCSNRSKAG SGSREESTGT PTSHGSCQGS PANDSAPVKD LTGSPVHEQC  780
NKVGCASELA FQPKRELNLS AAYTIPDALV VTKAQEPFGE MLIEDAGSSK DLRNLCPAVA  840
DAILDERVPE SSWVPESGWV NHQCPDLSMA AIEHAMPHAT ARQEMRSITI KATYKEDIIR  900
FRISLSSGIV ELKEEVAKRL KLEVGTFDIK YLDDDQEWVL IACNADLQEC IDVSRSSGCN  960
IIRLSVHDVN ALLGSSCEST GEL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00449DAPTransfer from AT4G24020Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012086674.10.0PREDICTED: protein NLP7-like
SwissprotQ84TH90.0NLP7_ARATH; Protein NLP7
TrEMBLA0A067JMR70.0A0A067JMR7_JATCU; Uncharacterized protein
STRINGPOPTR_0003s14300.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF42573456
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.10.0NIN like protein 7
Publications ? help Back to Top
  1. Zhang L, et al.
    Global analysis of gene expression profiles in physic nut (Jatropha curcas L.) seedlings exposed to salt stress.
    PLoS ONE, 2014. 9(5): p. e97878
    [PMID:24837971]